Superoxide Dismutase 2 Antibody / SOD2

Contact us
NSJ Bioreagents
Product Code: NSJ-R31882
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R31882-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
Applications:
  • Immunocytochemistry (ICC)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the SOD2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 5
Western blot testing of mouse 1) testis, 2) lung, 3) heart, 4) liver and 5) human HepG2 lysate with SOD2 antibody. Expected/observed molecular weight ~25 kDa.
2 / 5
IHC testing of FFPE human breast cancer with SOD2 antibdoy. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 5
ICC testing of FFPE human SMMC-7721 cells with SOD2 antibody. HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
4 / 5
ICC testing of FFPE human A549 cells with SOD2 antibody. HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
5 / 5
Western blot testing of mouse 1) human HepG2, 2) rat liver, 3) rat lung, 4) mouse liver and 5) mouse lung lysate with SOD2 antibody. Expected molecular weight ~25 kDa.
❮❯

Western blot testing of mouse 1) testis, 2) lung, 3) heart, 4) liver and 5) human HepG2 lysate with SOD2 antibody. Expected/observed molecular weight ~25 kDa.
IHC testing of FFPE human breast cancer with SOD2 antibdoy. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
ICC testing of FFPE human SMMC-7721 cells with SOD2 antibody. HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
ICC testing of FFPE human A549 cells with SOD2 antibody. HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Western blot testing of mouse 1) human HepG2, 2) rat liver, 3) rat lung, 4) mouse liver and 5) mouse lung lysate with SOD2 antibody. Expected molecular weight ~25 kDa.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,ICC (Paraffin): 0.5-1ug/ml
Application Note:
Optimal dilution of the SOD2 antibody should be determined by the researcher.
Description:
SOD2 (Superoxide Dismutase 2), also called IPO-B or MNSOD, is a mitochondrial matrix enzyme that scavenges oxygen radicals produced by the extensive oxidation-reduction and electron transport reactions occurring in mitochondria. This gene is a member of the iron/manganese superoxide dismutase family. Using a somatic cell hybrid panel containing different segments of chromosome 6, they demonstrated that SOD2 is located in the region 6q25.3-qter which, together with the FISH analysis, indicated that SOD2 is in the distal portion of 6q25. The SOD2 gene encodes an intramitochondrial free radical scavenging enzyme that is the first line of defense against superoxide produced as a byproduct of oxidative phosphorylation. Adeno-associated viral delivery of the human SOD2 gene resulted in suppression of optic nerve degeneration and rescue of retinal ganglion cells. The findings suggested that reactive oxygen species contributed to retinal cell death and optic nerve damage in mice with complex I deficiency, and that expression of SOD2 attenuated the disease process.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QYKNVRPDYLKAIWNVINWENVTERYMACKK of human SOD2 were used as the immunogen for the SOD2 antibody.
Limitation:
This SOD2 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse
Uniprot #:
P04179