Superoxide Dismutase 3 Antibody / SOD3
Code | Size | Price |
---|
NSJ-RQ4091-100ug | 100 ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Application: Immunohistochemistry- Paraffin Embedded (IHC-P)
Storage:
After reconstitution, the SOD3 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
Images
Documents
Further Information
Application Details :
Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the SOD3 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
SOD3 (Superoxide Dismutase 3), also called Superoxide Dismutase extracellular, EC-SOD, and Cu-Zn, is an enzyme that in humans is encoded by the SOD3 gene. This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the dismutation of two superoxide radicals into hydrogen peroxide and oxygen. Hendrickson et al. (1990) mapped the SOD3 gene to 4pter-q21 by a study of somatic cell hybrids. Stern et al. (2003) narrowed the assignment to 4p15.3-p15.1 by somatic cell and radiation hybrid analysis, linkage mapping, and FISH. The product of this gene is thought to protect the brain, lungs, and other tissues from oxidative stress. The protein is secreted into the extracellular space and forms a glycosylated homotetramer that is anchored to the extracellular matrix (ECM) and cell surfaces through an interaction with heparan sulfate proteoglycan and collagen. A fraction of the protein is cleaved near the C-terminus before secretion to generate circulating tetramers that do not interact with the ECM.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids WTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDD from the human protein were used as the immunogen for the SOD3 antibody.
Limitation:
This SOD3 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human
Uniprot #:
P08294