TCP1 gamma Antibody / CCT3

Contact us
NSJ Bioreagents
Product Code: NSJ-R32392
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32392-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Western Blot (WB)
Storage:
After reconstitution, the CCT3 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 10
Western blot testing of 1) rat kidney and 2) human HeLa lysate with CCT3 antibody. Expected/observed molecular weight ~61 kDa.
2 / 10
Flow cytometry testing of human U-251 MG cells with CCT3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CCT3 antibody.
3 / 10
Flow cytometry testing of human K562 cells with CCT3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CCT3 antibody.
4 / 10
Flow cytometry testing of human PC-3 cells with CCT3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CCT3 antibody.
5 / 10
IF/ICC staining of FFPE human A431 cells with CCT3 antibody (green) at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
6 / 10
IF/ICC staining of FFPE human A431 cells with CCT3 antibody (green) at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
7 / 10
IHC staining of FFPE human lung cancer with CCT3 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
8 / 10
IHC staining of FFPE human breast cancer with CCT3 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
9 / 10
IHC staining of FFPE human placenta with CCT3 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
10 / 10
IHC staining of FFPE human intestinal cancer with CCT3 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
❮❯

Western blot testing of 1) rat kidney and 2) human HeLa lysate with CCT3 antibody. Expected/observed molecular weight ~61 kDa.
Flow cytometry testing of human U-251 MG cells with CCT3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CCT3 antibody.
Flow cytometry testing of human K562 cells with CCT3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CCT3 antibody.
Flow cytometry testing of human PC-3 cells with CCT3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CCT3 antibody.
IF/ICC staining of FFPE human A431 cells with CCT3 antibody (green) at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
IF/ICC staining of FFPE human A431 cells with CCT3 antibody (green) at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
IHC staining of FFPE human lung cancer with CCT3 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human breast cancer with CCT3 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human placenta with CCT3 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human intestinal cancer with CCT3 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Flow cytometry: 1-3ug/million cells,Immunohistochemistry (FFPE): 1-2ug/ml,Immunofluorescence/Immunocytochemistry (FFPE): 2-4ug/ml
Application Note:
Optimal dilution of the CCT3 antibody should be determined by the researcher.
Description:
T-complex protein 1 subunit gamma is a protein that in humans is encoded by the CCT3 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ were used as the immunogen for the CCT3 antibody.
Limitation:
This CCT3 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Rat
Uniprot #:
P49368