TMEM107 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R32772
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32772-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the TMEM107 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 4
Western blot testing of human MCF7 cell lysate with TMEM107 antibody at 0.5ug/ml. Predicted molecular weight ~16 kDa, routinely observed at ~19 kDa.
2 / 4
IHC testing of FFPE human lung cancer tissue with TMEM107 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
3 / 4
IHC testing of FFPE human intestinal cancer tissue with TMEM107 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
4 / 4
Flow cytometry testing of human SiHa cells with TMEM107 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TMEM107 antibody.
❮❯

Western blot testing of human MCF7 cell lysate with TMEM107 antibody at 0.5ug/ml. Predicted molecular weight ~16 kDa, routinely observed at ~19 kDa.
IHC testing of FFPE human lung cancer tissue with TMEM107 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human intestinal cancer tissue with TMEM107 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Flow cytometry testing of human SiHa cells with TMEM107 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TMEM107 antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the TMEM107 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
Cilia are dynamic signaling organelles essential for developmental patterning, including left-right specification, skeletal formation, neural development, and organogenesis. TMEM107 is predicted to be critical for cilia formation and signaling in a subset of embryonic tissues. Based on an alignment of the TMEM107 sequence with the genomic sequence (GRCh38), the gene was mapped to chromosome 17p13.1.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 22-57 (VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL) from the human protein were used as the immunogen for the TMEM107 antibody.
Limitation:
This TMEM107 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
Q6UX40