TRPV5 Antibody
| Code | Size | Price |
|---|
| NSJ-R32330-100ug | 100 ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
- Human
- Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the TRPV5 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
Documents
Further Information
Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the TRPV5 antibody should be determined by the researcher.
Description:
Transient receptor potential cation channel subfamily V member 5 is a protein that in humans is encoded by the TRPV5 gene. This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. And this protein forms homotetramers or heterotetramers and is activated by a low internal calcium level. In addition, TRPV5 is mainly expressed in kidney epithelial cells, where it plays an important role in the reabsorption of Ca2+. Genetic deletion of TRPV5 in mice leads to Ca2+ loss in the urine, and consequential hyperparathyroidism, and bone loss.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DTHWRVAQERDELWRAQVVATTVMLERKLPR of human TRPV5 were used as the immunogen for the TRPV5 antibody.
Limitation:
This TRPV5 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Rat
Uniprot #:
Q9NQA5