UBE2Q2 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R32289
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32289-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the UBE2Q2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 4
Immunofluorescent staining of FFPE human U-2 OS cells with UBE2Q2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 4
IHC testing of FFPE human lung cancer tissue with UBE2Q2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 4
Western blot testing of human 1) HeLa, 2) A431, 3) MCF7, and 4) SW620 cell lysate with UBE2Q2 antibody. Predicted molecular weight ~43 kDa, routinely observed at 43-46 kDa.
4 / 4
Flow cytometry testing of human A549 cells with UBE2Q2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= UBE2Q2 antibody.
❮❯

Immunofluorescent staining of FFPE human U-2 OS cells with UBE2Q2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE human lung cancer tissue with UBE2Q2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Western blot testing of human 1) HeLa, 2) A431, 3) MCF7, and 4) SW620 cell lysate with UBE2Q2 antibody. Predicted molecular weight ~43 kDa, routinely observed at 43-46 kDa.
Flow cytometry testing of human A549 cells with UBE2Q2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= UBE2Q2 antibody.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the UBE2Q2 antibody should be determined by the researcher.
Description:
UBE2Q2 is identified as a putative ubiquitin-conjugating enzyme (E2) in a microarray screen for mitotic regulatory proteins. Its gene is mapped to 15q24.2. It can covalently bind ubiquitin on the active site cysteine within the UBC domain. Inhibition of UBE2Q2 in HeLa cells causes an early mitotic arrest and increases cytotoxicity when the cells are treated with microtubule-inhibiting agents (MIAs). Changes in cell cycle progression and viability are not observed in the absence of MIA treatment, indicating that UBE2Q2 is involved in the response to MIAs rather than performing a more general function in mitosis. Moreover, inhibition of the protein causes cells to undergo a prolonged prophase arrest, suggesting that UBE2Q2 normally functions to antagonize an early mitotic checkpoint. Finally, inhibition of UBE2Q2 also sensitizes cells to the cytotoxic effects of MIAs through caspase-mediated apoptosis that is correlated with PARP1 cleavage.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ of human UBE2Q2 were used as the immunogen for the UBE2Q2 antibody.
Limitation:
This UBE2Q2 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
Q8WVN8