YAP1 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R32393
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32393-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the YAP1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 3
Immunofluorescent staining of FFPE human SK-OV-3 cells with YAP1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 3
Flow cytometry testing of human HepG2 cells with YAP1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= YAP1 antibody.
3 / 3
Western blot testing of 1) rat testis, 2) mouse ovary, 3) human HeLa and 4) human MCF7 lysate with YAP1 antibody. Predicted molecular weight: 54 kDa but routinely observed at 65-70 kDa.
❮❯

Immunofluorescent staining of FFPE human SK-OV-3 cells with YAP1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human HepG2 cells with YAP1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= YAP1 antibody.
Western blot testing of 1) rat testis, 2) mouse ovary, 3) human HeLa and 4) human MCF7 lysate with YAP1 antibody. Predicted molecular weight: 54 kDa but routinely observed at 65-70 kDa.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the YAP1 antibody should be determined by the researcher.
Description:
Yes-associated protein 1, also known as YAP or YAP65, is a potent oncogene, which is amplified in various human cancers. This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. It is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids ETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFK from the human protein were used as the immunogen for the YAP1 antibody.
Limitation:
This YAP1 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P46937