Inhibitors and Activators
Showing 1000 of 56287 products meeting your criteria.
| ID | Code | Name | Supplier | |
|---|---|---|---|---|
| 1501756 | TAR-T38697 | [Tyr(P)4]?Angiotensin?II | TargetMol | |
| 1501755 | TAR-T38696 | Rp-8-CPT-cAMPS | TargetMol | |
| 1501754 | TAR-T38694 | Sp-8-CPT-cAMPS | TargetMol | |
| 1501753 | TAR-T38692 | Fabesetron | TargetMol | |
| 1501752 | TAR-T38686 | Melarsomine | TargetMol | |
| 1501751 | TAR-T38685 | C12-Sphingosine | TargetMol | |
| 1501750 | TAR-T38683 | SCD1 inhibitor-3 | TargetMol | |
| 1501749 | TAR-T38681 | p-SCN-Bn-DOTA | TargetMol | |
| 1501748 | TAR-T38680 | RJW100 | TargetMol | |
| 1501746 | TAR-T38676 | 5'-O-DMT-2'-O-TBDMS-rI | TargetMol | |
| 1501745 | TAR-T38675 | Hikizimycin | TargetMol | |
| 1501744 | TAR-T38673 | Sibiromycin | TargetMol | |
| 1501742 | TAR-T38668 | endo-BCN-O-PNB | TargetMol | |
| 1501741 | TAR-T38666 | CP-346086 dihydrate | TargetMol | |
| 1501740 | TAR-T38662 | Fmoc-Gly-Thr(psi(Me,Me)pro)-OH | TargetMol | |
| 1501739 | TAR-T38660 | AT-9010 | TargetMol | |
| 1501738 | TAR-T38659 | mGluR5 modulator 1 | TargetMol | |
| 1501737 | TAR-T38656 | Nusinersen | TargetMol | |
| 1501736 | TAR-T38653 | HG-7-85-01 | TargetMol | |
| 1501735 | TAR-T38652 | Decyl maltose neopentyl glycol | TargetMol | |
| 1501734 | TAR-T38650 | Lyciumin B | TargetMol | |
| 1501733 | TAR-T38649 | Lyciumin A | TargetMol | |
| 1501732 | TAR-T38644 | Docetaxal | TargetMol | |
| 1501731 | TAR-T38643 | Cefixime trihydrate | TargetMol | |
| 1501729 | TAR-T38641 | AP 811 | TargetMol | |
| 1501728 | TAR-T38640 | PLK4-IN-3 | TargetMol | |
| 1501726 | TAR-T38639 | PLK4-IN-1 | TargetMol | |
| 1501725 | TAR-T38637 | Roy-Bz | TargetMol | |
| 1501724 | TAR-T38635 | Kdo2-Lipid A ammonium | TargetMol | |
| 1501723 | TAR-T38630 | Ludaterone | TargetMol | |
| 1501722 | TAR-T38626 | GSK143 | TargetMol | |
| 1501721 | TAR-T38625 | Tanimilast | TargetMol | |
| 1501720 | TAR-T38621 | SJM-3 | TargetMol | |
| 1501719 | TAR-T38620 | Prexasertib dimesylate | TargetMol | |
| 1501718 | TAR-T38619 | GSK1795091 | TargetMol | |
| 1501717 | TAR-T38616 | Teprasiran | TargetMol | |
| 1501716 | TAR-T38613 | Tigecycline hydrate | TargetMol | |
| 1501715 | TAR-T38609 | Mycalolide B | TargetMol | |
| 1501714 | TAR-T38607 | Etoposide phosphate disodium | TargetMol | |
| 1501713 | TAR-T38606 | Sinapine hydroxide | TargetMol | |
| 1501712 | TAR-T38605 | NCT-504 | TargetMol | |
| 1501711 | TAR-T38601 | GYKI-47261 dihydrochloride | TargetMol | |
| 1501710 | TAR-T38598 | CBK289001 | TargetMol | |
| 1501709 | TAR-T38597 | SPDP-sulfo | TargetMol | |
| 1501708 | TAR-T38596 | 9,10-Dihydroxystearic acid | TargetMol | |
| 1501707 | TAR-T38595 | EP4 receptor antagonist 3 | TargetMol | |
| 1501706 | TAR-T38594 | MK-5204 | TargetMol | |
| 1501705 | TAR-T38592 | Regaloside F | TargetMol | |
| 1501704 | TAR-T38589 | Neopanaxadiol | TargetMol | |
| 1501703 | TAR-T38588 | Amphotericin B trihydrate | TargetMol | |
| 1501702 | TAR-T38586 | Grepafloxacin | TargetMol | |
| 1501701 | TAR-T38585 | Tetrachlorocatechol | TargetMol | |
| 1501700 | TAR-T38584 | ALK-IN-12 | TargetMol | |
| 1501699 | TAR-T38583 | ALK-IN-13 | TargetMol | |
| 1501698 | TAR-T38581 | Antofloxacin | TargetMol | |
| 1501697 | TAR-T38579 | Rutarensin | TargetMol | |
| 1501695 | TAR-T38568 | Dibromochloronitromethane | TargetMol | |
| 1501694 | TAR-T38566 | Bz-rC Phosphoramidite | TargetMol | |
| 1501693 | TAR-T38565 | Testosterone glucuronide | TargetMol | |
| 1501692 | TAR-T38557 | Chitotriose trihydrochloride | TargetMol | |
| 1501691 | TAR-T38556 | Larsucosterol sodium | TargetMol | |
| 1501690 | TAR-T38553 | Previtamin D3 | TargetMol | |
| 1501689 | TAR-T38551 | Liproxstatin-1 analog | TargetMol | |
| 1501688 | TAR-T38550 | Onilcamotide | TargetMol | |
| 1501685 | TAR-T38546 | 5-Propargylamino-dCTP | TargetMol | |
| 1501684 | TAR-T38544 | Fasitibant chloride | TargetMol | |
| 1501683 | TAR-T38542 | H-D-Phe-Pip-Arg-pNA acetate | TargetMol | |
| 1501682 | TAR-T38540 | BAY 1003803 | TargetMol | |
| 1501681 | TAR-T38539 | Luseogliflozin hydrate | TargetMol | |
| 1501680 | TAR-T38538 | BGN3 | TargetMol | |
| 1501679 | TAR-T38535 | Fmoc-Ile-Ser(psi(Me,Me)pro)-OH | TargetMol | |
| 1501678 | TAR-T38533 | 7-Iodo-2',3'-dideoxy-7-deazaadenosine | TargetMol | |
| 1501676 | TAR-T38528 | 5-Propargylamino-ddUTP | TargetMol | |
| 1501675 | TAR-T38527 | 2',3'-Dideoxy-5-iodocytidine | TargetMol | |
| 1501674 | TAR-T38526 | 5-Propargylamino-ddCTP | TargetMol | |
| 1501673 | TAR-T38523 | Tris-NTA | TargetMol | |
| 1501672 | TAR-T38521 | Patamostat mesylate | TargetMol | |
| 1501670 | TAR-T38519 | YB-0158 | TargetMol | |
| 1501669 | TAR-T38518 | (R)-Fluoxetine hydrochloride | TargetMol | |
| 1501668 | TAR-T38517 | (S)-Fluoxetine hydrochloride | TargetMol | |
| 1501667 | TAR-T38515 | Ascr#7 | TargetMol | |
| 1501666 | TAR-T38513 | Cefoperazone dihydrate | TargetMol | |
| 1501665 | TAR-T38507 | Renzapride | TargetMol | |
| 1501664 | TAR-T38506 | cis-Clopidogrel-MP derivative | TargetMol | |
| 1501663 | TAR-T38505 | Br-Boc-C2-azido | TargetMol | |
| 1501662 | TAR-T38502 | IGF-1R inhibitor-2 | TargetMol | |
| 1501661 | TAR-T38500 | Enduracidin | TargetMol | |
| 1501660 | TAR-T38499 | κ-Carrageenan | TargetMol | |
| 1501659 | TAR-T38497 | (-)-Taxifolin | TargetMol | |
| 1501658 | TAR-T38496 | IBU-DC Phosphoramidite | TargetMol | |
| 1501657 | TAR-T38490 | ONX 0801 trisodium | TargetMol | |
| 1501656 | TAR-T3849 | Kinsenoside | TargetMol | |
| 1501655 | TAR-T38489 | D,L-erythro-PDMP | TargetMol | |
| 1501654 | TAR-T38488 | S32826 | TargetMol | |
| 1501653 | TAR-T38487 | 1,3-Dibromopropane | TargetMol | |
| 1501652 | TAR-T38486 | U50488 hydrochloride | TargetMol | |
| 1501651 | TAR-T38485L | Fmoc-Gly-Ser(psi(Me,Me)pro)-OH acetate | TargetMol | |
| 1501650 | TAR-T38484 | Englerin A | TargetMol | |
| 1501649 | TAR-T38481 | Camellianin B | TargetMol | |
| 1501647 | TAR-T38477 | Isonaringin | TargetMol | |
| 1501646 | TAR-T38474 | CL2-MMT-SN38 | TargetMol | |
| 1501645 | TAR-T38473 | Malonyl Coenzyme A lithium | TargetMol | |
| 1501644 | TAR-T38472 | Phosphoribosyl pyrophosphate pentasodium | TargetMol | |
| 1501643 | TAR-T38471 | HM03 trihydrochloride | TargetMol | |
| 1501641 | TAR-T38469 | Cathepsin L-IN-2 | TargetMol | |
| 1501640 | TAR-T38466 | 4-APC hydrobromide | TargetMol | |
| 1501639 | TAR-T38464 | Miravirsen | TargetMol | |
| 1501638 | TAR-T38462 | PF-04577806 | TargetMol | |
| 1501637 | TAR-T38461 | PF-03622905 | TargetMol | |
| 1501636 | TAR-T38458 | Faropenem | TargetMol | |
| 1501635 | TAR-T38456 | Tribenuron | TargetMol | |
| 1501634 | TAR-T38454 | N6-Methyl-dA phosphoramidite | TargetMol | |
| 1501632 | TAR-T38445 | ANAT?inhibitor-2 | TargetMol | |
| 1501631 | TAR-T38444 | α,β-Methylene-ATP dilithium | TargetMol | |
| 1501630 | TAR-T38443 | Methoctramine tetrahydrochloride | TargetMol | |
| 1501629 | TAR-T38441 | Manzamine A hydrochloride | TargetMol | |
| 1501628 | TAR-T38439 | DC-Srci-6649 | TargetMol | |
| 1501627 | TAR-T38438 | 3-Aminopropylphosphinic acid | TargetMol | |
| 1501626 | TAR-T38437 | NMTCA | TargetMol | |
| 1501625 | TAR-T38436 | JAK-2/3-IN-1 | TargetMol | |
| 1501624 | TAR-T38434 | (-)-(S)-Cibenzoline | TargetMol | |
| 1501623 | TAR-T38432 | Cyanine5 NHS ester chloride | TargetMol | |
| 1501621 | TAR-T38430 | Tubulysin IM-2 | TargetMol | |
| 1501620 | TAR-T38429 | (+)-Intermedine | TargetMol | |
| 1501619 | TAR-T38428 | Alisertib sodium | TargetMol | |
| 1501618 | TAR-T38427 | dUTP trisodium | TargetMol | |
| 1501617 | TAR-T38425 | Ac-dA Phosphoramidite | TargetMol | |
| 1501616 | TAR-T38424 | (R)-Fadrozole | TargetMol | |
| 1501615 | TAR-T38422 | Nelonicline citrate | TargetMol | |
| 1501614 | TAR-T38421 | PRMT1-IN-1 | TargetMol | |
| 1501613 | TAR-T38420 | GCPII-IN-1 | TargetMol | |
| 1501611 | TAR-T38417 | Kushenol O | TargetMol | |
| 1501610 | TAR-T38416 | Adenosine 5'-succinate | TargetMol | |
| 1501609 | TAR-T38414 | NSC 80467 | TargetMol | |
| 1501608 | TAR-T38413 | Pyrrolnitrin | TargetMol | |
| 1501607 | TAR-T38412 | (S)-Nornicotine hydrochloride | TargetMol | |
| 1501606 | TAR-T38410 | Phosphoramide mustard | TargetMol | |
| 1501605 | TAR-T38407 | RTIL 13 | TargetMol | |
| 1501604 | TAR-T38405 | 5'-O-DMT-ibu-dC | TargetMol | |
| 1501603 | TAR-T38404 | MJ33 lithium salt | TargetMol | |
| 1501601 | TAR-T38399 | (Rac)-Golgicide A | TargetMol | |
| 1501600 | TAR-T38397 | BMS-753426 | TargetMol | |
| 1501599 | TAR-T38396 | Ganoderic acid J | TargetMol | |
| 1501598 | TAR-T38394 | PSM α3 | TargetMol | |
| 1501597 | TAR-T38393 | Ipatasertib-NH2 dihydrochloride | TargetMol | |
| 1501596 | TAR-T38392 | JAMI1001A | TargetMol | |
| 1501595 | TAR-T38386 | Drimentine C | TargetMol | |
| 1501594 | TAR-T38385 | IT-143B | TargetMol | |
| 1501593 | TAR-T38382 | 8Br-HA | TargetMol | |
| 1501592 | TAR-T38373 | 2-heptyl-3-hydroxy-4(1H)-Quinolone | TargetMol | |
| 1501591 | TAR-T38363 | MeOSuc-AAPV-pNA | TargetMol | |
| 1501589 | TAR-T38358 | 1,3-Distearoyl-2-Oleoyl-rac-glycerol | TargetMol | |
| 1501588 | TAR-T38348 | α-Lipomycin | TargetMol | |
| 1501587 | TAR-T38341 | 11(Z),14(Z)-Eicosadienoic Acid methyl ester | TargetMol | |
| 1501586 | TAR-T38335 | Viridicatin | TargetMol | |
| 1501585 | TAR-T38330 | Collinin | TargetMol | |
| 1501583 | TAR-T38327 | Cryogenine | TargetMol | |
| 1501582 | TAR-T38325 | Coumarin Boronic Acid pinacolate ester | TargetMol | |
| 1501581 | TAR-T38322 | A-54556B | TargetMol | |
| 1501580 | TAR-T38321 | A-39183A | TargetMol | |
| 1501579 | TAR-T3832 | 11-O-Galloylbergenin | TargetMol | |
| 1501578 | TAR-T38316 | ABC34 | TargetMol | |
| 1501577 | TAR-T38314 | Parvodicin Complex | TargetMol | |
| 1501576 | TAR-T38313 | L-Homoserine lactone (hydrochloride) | TargetMol | |
| 1501575 | TAR-T38311 | (S)-3-Thienylglycine | TargetMol | |
| 1501573 | TAR-T38304 | Ascr#18 | TargetMol | |
| 1501572 | TAR-T38302 | Chrysomycin B | TargetMol | |
| 1501571 | TAR-T38300 | Acetyl-L-Homoserine lactone | TargetMol | |
| 1501570 | TAR-T38294 | 4-Deoxypyridoxine hydrochloride | TargetMol | |
| 1501569 | TAR-T38290 | Leucomycin A4 | TargetMol | |
| 1501568 | TAR-T38289 | Leucomycin A13 | TargetMol | |
| 1501567 | TAR-T38272 | Thiacloprid | TargetMol | |
| 1501566 | TAR-T38271 | TH1217 | TargetMol | |
| 1501564 | TAR-T38267 | Valeryl-L-carnitine (chloride) | TargetMol | |
| 1501563 | TAR-T38266 | Nirogacestat dihydrobromide | TargetMol | |
| 1501562 | TAR-T38262 | Sphingosine (d14:1) | TargetMol | |
| 1501561 | TAR-T38259 | Phenelfamycin E | TargetMol | |
| 1501560 | TAR-T38258 | Phanerosporic Acid | TargetMol | |
| 1501559 | TAR-T38254 | Cathepsin D and E FRET Substrate acetate | TargetMol | |
| 1501558 | TAR-T38253 | Lauroyl-L-carnitine (chloride) | TargetMol | |
| 1501557 | TAR-T38247 | Lactoferricin B (4-14), bovine TFA | TargetMol | |
| 1501556 | TAR-T38244 | L-156,602 | TargetMol | |
| 1501555 | TAR-T38243 | Hygrolidin | TargetMol | |
| 1501554 | TAR-T38242 | Ilimaquinone | TargetMol | |
| 1501553 | TAR-T38234 | HCoV-229E-IN-1 | TargetMol | |
| 1501552 | TAR-T38233 | Hexanoyl-L-carnitine (chloride) | TargetMol | |
| 1501551 | TAR-T38232 | Heptanoyl-L-carnitine (chloride) | TargetMol | |
| 1501550 | TAR-T38229 | JF-NP-26 | TargetMol | |
| 1501549 | TAR-T38220 | 11-cis Retinol | TargetMol | |
| 1501547 | TAR-T38218 | 1-Stearoyl-2-docosahexaenoyl-sn-glycero-3-PC | TargetMol | |
| 1501546 | TAR-T38217 | 1-Stearoyl-2-Adrenoyl-sn-glycero-3-PE | TargetMol | |
| 1501545 | TAR-T38216 | 1-Palmitoyl-2-Oleoyl-3-Arachidonoyl-rac-glycerol | TargetMol | |
| 1501544 | TAR-T38210 | Hodgkinsine B | TargetMol | |
| 1501543 | TAR-T38209 | Hodgkinsine | TargetMol | |
| 1501542 | TAR-T38205 | 3-Aminopropylphosphonic Acid | TargetMol | |
| 1501541 | TAR-T38203 | Gastrin I, rat | TargetMol | |
| 1501540 | TAR-T38199 | (±)-WIN 55,212 (mesylate) | TargetMol | |
| 1501539 | TAR-T38191 | Unguisin B | TargetMol | |
| 1501538 | TAR-T38189 | 2-hydroxy Lignoceric Acid | TargetMol | |
| 1501537 | TAR-T38187 | 6-Aminophenanthridine | TargetMol | |
| 1501536 | TAR-T38182 | C17 Sphingomyelin (d18:1/17:0) | TargetMol | |
| 1501535 | TAR-T38180 | C16 Phytoceramide (t18:0/16:0) | TargetMol | |
| 1501533 | TAR-T38177 | Flambalactone | TargetMol | |
| 1501532 | TAR-T38174 | Mpro inhibitor N3 hemihydrate | TargetMol | |
| 1501531 | TAR-T38172 | RO 5263397 hydrochloride | TargetMol | |
| 1501529 | TAR-T38152 | Gilvocarcin M | TargetMol | |
| 1501528 | TAR-T38150 | Geninthiocin A | TargetMol | |
| 1501527 | TAR-T38145 | Eltoprazine | TargetMol | |
| 1501526 | TAR-T38140 | Phosphatidylethanolamines (bovine) | TargetMol | |
| 1501524 | TAR-T38135 | 3,4-Dehydro Cilostazol | TargetMol | |
| 1501523 | TAR-T38133 | (S)-Nornicotine | TargetMol | |
| 1501522 | TAR-T38131 | (E)-10-Hydroxynortriptyline | TargetMol | |
| 1501521 | TAR-T38129 | Leukotriene F4 | TargetMol | |
| 1501520 | TAR-T38116 | Fmoc-Ala-Glu-Asn-Lys-NH2 | TargetMol | |
| 1501519 | TAR-T38113 | AL 6598 | TargetMol | |
| 1501518 | TAR-T38107 | JJH260 | TargetMol | |
| 1501517 | TAR-T38106 | JC-171 | TargetMol | |
| 1501516 | TAR-T38102 | Decatromicin B | TargetMol | |
| 1501515 | TAR-T38096 | MLT-231 | TargetMol | |
| 1501514 | TAR-T38093 | NT1-O12B | TargetMol | |
| 1501513 | TAR-T38089 | 2F-Peracetyl-Fucose | TargetMol | |
| 1501512 | TAR-T38080 | DL-threo-PDMP (hydrochloride) | TargetMol | |
| 1501510 | TAR-T38078 | TLR7/8-IN-1 | TargetMol | |
| 1501509 | TAR-T38075 | ThioFluor 623 | TargetMol | |
| 1501508 | TAR-T38069 | Aquastatin A | TargetMol | |
| 1501507 | TAR-T38068 | Aptiganel hydrochloride | TargetMol | |
| 1501505 | TAR-T38054 | Avenaciolide | TargetMol | |
| 1501504 | TAR-T38052 | CRA-2059 TFA | TargetMol | |
| 1501503 | TAR-T38051 | CRA-2059 hydrochloride | TargetMol | |
| 1501502 | TAR-T38048 | Globotetraosylceramides (porcine RBC) | TargetMol | |
| 1501501 | TAR-T38037 | Caffeic Acid-13C3 | TargetMol | |
| 1501500 | TAR-T38036 | Lumisterol | TargetMol | |
| 1501499 | TAR-T38023 | FTISADTSK acetate | TargetMol | |
| 1501498 | TAR-T38019 | Nybomycin | TargetMol | |
| 1501497 | TAR-T38010 | PPHP | TargetMol | |
| 1501496 | TAR-T38007 | Noladin ether | TargetMol | |
| 1501494 | TAR-T37999 | Lysophosphatidylethanolamines (egg) | TargetMol | |
| 1501493 | TAR-T37992 | 15-methyl Palmitic Acid | TargetMol | |
| 1501491 | TAR-T37977 | Succinyladenosine | TargetMol | |
| 1501490 | TAR-T37974 | (S)-Coriolic acid | TargetMol | |
| 1501489 | TAR-T37966 | T-91825 | TargetMol | |
| 1501488 | TAR-T37964 | Dicresulene diammonium | TargetMol | |
| 1501487 | TAR-T37957 | Setosusin | TargetMol | |
| 1501485 | TAR-T37929 | 14-dehydro Zymostenol | TargetMol | |
| 1501484 | TAR-T37926 | 7-Ethoxy-4-(trifluoromethyl)coumarin | TargetMol | |
| 1501483 | TAR-T37925 | 7-Biopterin | TargetMol | |
| 1501482 | TAR-T37921 | 7(Z),11(Z)-Nonacosadiene | TargetMol | |
| 1501481 | TAR-T37915 | Monodes(N-carboxymethyl)valine Daclatasvir | TargetMol | |
| 1501480 | TAR-T37912 | Furanone C-30 | TargetMol | |
| 1501479 | TAR-T37911 | cis-Resveratrol | TargetMol | |
| 1501478 | TAR-T37909 | Tenofovir diphosphate | TargetMol | |
| 1501477 | TAR-T37902 | Uridine-5'-diphosphoglucuronic Acid (sodium salt hydrate) | TargetMol | |
| 1501476 | TAR-T37900 | UDP-Glucuronic Acid (sodium salt hydrate) | TargetMol | |
| 1501475 | TAR-T37891 | GLP-1(32-36)amide | TargetMol | |
| 1501474 | TAR-T37890 | GLP-1(28-36)amide | TargetMol | |
| 1501473 | TAR-T37879 | N-undecanoyl-L-Homoserine lactone | TargetMol | |
| 1501472 | TAR-T37878 | N-tridecanoyl-L-Homoserine lactone | TargetMol | |
| 1501470 | TAR-T3786L | Tomatine hydrochloride | TargetMol | |
| 1501469 | TAR-T37869 | BODIPY aminoacetaldehyde | TargetMol | |
| 1501468 | TAR-T37861 | Talabostat | TargetMol | |
| 1501467 | TAR-T37855 | 7-hydroxycoumarinyl-γ-Linolenate | TargetMol | |
| 1501466 | TAR-T37851 | Chlorido[N,N'-disalicylidene-1,2-phenylenediamine]iron(III) | TargetMol | |
| 1501465 | TAR-T37848 | Brombuterol hydrochloride | TargetMol | |
| 1501464 | TAR-T37847 | Zonisamide-13C2,15N | TargetMol | |
| 1501463 | TAR-T37844 | Kigamicin C | TargetMol | |
| 1501462 | TAR-T37843 | Australine (hydrochloride) | TargetMol | |
| 1501460 | TAR-T37826 | CAY10462 | TargetMol | |
| 1501459 | TAR-T37824 | MCT4-IN-1 | TargetMol | |
| 1501458 | TAR-T37821 | AP 14145 hydrochloride | TargetMol | |
| 1501457 | TAR-T37817 | Terazosin dimer impurity dihydrochloride | TargetMol | |
| 1501456 | TAR-T37815 | PM226 | TargetMol | |
| 1501455 | TAR-T37814 | PKRA 7 | TargetMol | |
| 1501454 | TAR-T37811 | 6-Chloro-3-indolyl-β-D-Glucuronide (cyclohexylammonium salt) | TargetMol | |
| 1501453 | TAR-T37809 | Alphitonin | TargetMol | |
| 1501452 | TAR-T37805 | JKE-1716 | TargetMol | |
| 1501451 | TAR-T37800 | PF-04449613 | TargetMol | |
| 1501449 | TAR-T37787 | 10-Nitrolinoleic acid | TargetMol | |
| 1501448 | TAR-T37785 | 1-Palmitoyl-2-linoleoyl PE | TargetMol | |
| 1501447 | TAR-T37774 | Thielavin A | TargetMol | |
| 1501446 | TAR-T37758 | Unguinol | TargetMol | |
| 1501444 | TAR-T37747 | N-tetradecanoyl-L-Homoserine lactone | TargetMol | |
| 1501443 | TAR-T37745 | N-pentadecanoyl-L-Homoserine lactone | TargetMol | |
| 1501442 | TAR-T37744 | N-octanoyl-L-Homoserine lactone | TargetMol | |
| 1501441 | TAR-T37743 | N-octadecanoyl-L-Homoserine lactone | TargetMol | |
| 1501440 | TAR-T37742 | N-hexanoyl-DL-Homoserine lactone | TargetMol | |
| 1501439 | TAR-T37741 | N-hexadecanoyl-L-Homoserine lactone | TargetMol | |
| 1501438 | TAR-T37740 | N-Demethylvancomycin (hydrochloride) | TargetMol | |
| 1501437 | TAR-T37739 | N-decanoyl-L-Homoserine lactone | TargetMol | |
| 1501436 | TAR-T37738 | N-cis-tetradec-9Z-enoyl-L-Homoserine lactone | TargetMol | |
| 1501435 | TAR-T37737 | N-cis-octadec-9Z-enoyl-L-Homoserine lactone | TargetMol | |
| 1501434 | TAR-T37736 | N-cis-hexadec-9Z-enoyl-L-Homoserine lactone | TargetMol | |
| 1501433 | TAR-T37735 | Stearoyl-L-carnitine chloride | TargetMol | |
| 1501432 | TAR-T37733 | AMP-PNP tetralithium | TargetMol | |
| 1501431 | TAR-T37731 | TPU-0037A | TargetMol | |
| 1501430 | TAR-T37730 | Saccharocarcin A | TargetMol | |
| 1501429 | TAR-T37728 | Methoctramine (hydrate) | TargetMol | |
| 1501428 | TAR-T37723 | IT-143A | TargetMol | |
| 1501427 | TAR-T37721 | Dihydronovobiocin | TargetMol | |
| 1501425 | TAR-T37713 | Funalenone | TargetMol | |
| 1501424 | TAR-T37707 | 14-Anhydrodigitoxigenin | TargetMol | |
| 1501423 | TAR-T37702 | Pancuronium (bromide hydrate) | TargetMol | |
| 1501422 | TAR-T37696 | NOS1-IN-1 | TargetMol | |
| 1501421 | TAR-T37695 | NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ | TargetMol | |
| 1501419 | TAR-T37688 | Cyfluthrin | TargetMol | |
| 1501418 | TAR-T37682 | 3-hydroxy Tridecanoic Acid | TargetMol | |
| 1501417 | TAR-T37680 | 3-hydroxy Palmitic Acid methyl ester | TargetMol | |
| 1501415 | TAR-T37676 | 3-hydroxy Decanoic Acid methyl ester | TargetMol | |
| 1501414 | TAR-T37672 | Aspartocin D | TargetMol | |
| 1501413 | TAR-T37669 | CAY10498 | TargetMol | |
| 1501412 | TAR-T37667 | True Blue | TargetMol | |
| 1501411 | TAR-T37664 | Emideltide (acetate) | TargetMol | |
| 1501410 | TAR-T37663 | Emamectin B1a | TargetMol | |
| 1501408 | TAR-T37657 | Mitochondrial respiration-IN-1 hydrobromide | TargetMol | |
| 1501407 | TAR-T37650 | 5(S),15(S)-DiHETE | TargetMol | |
| 1501405 | TAR-T37645 | Dasatinib metabolite M6 | TargetMol | |
| 1501404 | TAR-T37642 | Pravastatin lactone | TargetMol | |
| 1501403 | TAR-T3764 | 1-?Triacontanol | TargetMol | |
| 1501402 | TAR-T37639 | Toltrazuril sulfoxide | TargetMol | |
| 1501401 | TAR-T37638 | Tofacitinib metabolite-1 | TargetMol | |
| 1501400 | TAR-T37628 | Ibuprofen impurity 1 | TargetMol | |
| 1501399 | TAR-T37614 | LDN-0088050 | TargetMol | |
| 1501398 | TAR-T37610 | AT-121 | TargetMol | |
| 1501397 | TAR-T37608 | Riluzole-13C,15N2 | TargetMol | |
| 1501396 | TAR-T37601 | GIP (1-30) amide, porcine TFA | TargetMol | |
| 1501395 | TAR-T37599 | DA-JC4 | TargetMol | |
| 1501394 | TAR-T37593 | FK 866 hydrochloride | TargetMol | |
| 1501393 | TAR-T37590 | ML 3403 | TargetMol | |
| 1501392 | TAR-T37585 | Ensartinib | TargetMol | |
| 1501391 | TAR-T37582 | Ganglioside GM1 Mixture (ovine) (ammonium salt) | TargetMol | |
| 1501390 | TAR-T37580 | Arachidonoyl thio-PC | TargetMol | |
| 1501389 | TAR-T37576 | Callosobruchusic Acid | TargetMol | |
| 1501388 | TAR-T3757 | NQ301 | TargetMol | |
| 1501387 | TAR-T37561 | BX-320 | TargetMol | |
| 1501386 | TAR-T37560 | Nidulin | TargetMol | |
| 1501385 | TAR-T37557 | (-)-( α)-Kainic Acid (hydrate) | TargetMol | |
| 1501384 | TAR-T37556 | CAY10502 | TargetMol | |
| 1501383 | TAR-T37549 | Bacillosporin C | TargetMol | |
| 1501382 | TAR-T37547 | trans-Urocanic Acid | TargetMol | |
| 1501381 | TAR-T37546 | TPU-0037C | TargetMol | |
| 1501380 | TAR-T37539 | Amycolatopsin A | TargetMol | |
| 1501379 | TAR-T37532 | Docosahexaenoyl Glycine | TargetMol | |
| 1501378 | TAR-T37525 | 2-Methylthio-AMP diTEA | TargetMol | |
| 1501377 | TAR-T37521 | DL-Glyceraldehyde 3-phosphate | TargetMol | |
| 1501376 | TAR-T37519 | Diquat (bromide) | TargetMol | |
| 1501375 | TAR-T37517 | D-NMMA (acetate) | TargetMol | |
| 1501374 | TAR-T37509 | Saccharocarcin B | TargetMol | |
| 1501373 | TAR-T37502 | sn-Glycerol 3-phosphate lithium | TargetMol | |
| 1501372 | TAR-T37498 | Antimycin A4 | TargetMol | |
| 1501371 | TAR-T37494 | 11-trans Leukotriene E4 | TargetMol | |
| 1501370 | TAR-T37482 | Diclofenac methyl ester | TargetMol | |
| 1501369 | TAR-T37476 | Cyclo(L-Phe-L-Val) | TargetMol | |
| 1501368 | TAR-T37474 | meta-Fluoxetine (hydrochloride) | TargetMol | |
| 1501367 | TAR-T37471 | Makisterone A | TargetMol | |
| 1501366 | TAR-T37470 | Bismuth subcarbonate | TargetMol | |
| 1501365 | TAR-T37469 | Sitamaquine tosylate | TargetMol | |
| 1501364 | TAR-T37467 | SGC 6870N | TargetMol | |
| 1501363 | TAR-T37458 | C18 Phytoceramide (t18:0/18:0) | TargetMol | |
| 1501362 | TAR-T37452 | Stephacidin B | TargetMol | |
| 1501361 | TAR-T37448 | UZH1a | TargetMol | |
| 1501360 | TAR-T37447 | UZH1 | TargetMol | |
| 1501359 | TAR-T37445 | Etanercept | TargetMol | |
| 1501358 | TAR-T37440 | C2 Adamantanyl Galactosylceramide (d18:1/2:0) | TargetMol | |
| 1501357 | TAR-T37437 | C17 Ceramide (d18:1/17:0) | TargetMol | |
| 1501356 | TAR-T37432 | Erythromycin A N-oxide | TargetMol | |
| 1501355 | TAR-T37429 | TRPV3 antagonist 74a | TargetMol | |
| 1501354 | TAR-T37426 | FIIN-1 | TargetMol | |
| 1501353 | TAR-T37419 | Zetomipzomib | TargetMol | |
| 1501351 | TAR-T37412 | AZ-GHS-22 | TargetMol | |
| 1501350 | TAR-T37408 | Bischloroanthrabenzoxocinone | TargetMol | |
| 1501349 | TAR-T37406 | Apovincaminic acid hydrochloride salt | TargetMol | |
| 1501348 | TAR-T37404 | O-Desmethylangolensin | TargetMol | |
| 1501347 | TAR-T37391 | PSEM 308 hydrochloride | TargetMol | |
| 1501346 | TAR-T37389 | NS 383 | TargetMol | |
| 1501345 | TAR-T37379 | Protectin D1 | TargetMol | |
| 1501344 | TAR-T37375 | Uridine-3'-monophosphate (sodium salt) | TargetMol | |
| 1501343 | TAR-T37374 | URB754 | TargetMol | |
| 1501339 | TAR-T37347 | 6'-Sialyllactose Sodium Salt | TargetMol | |
| 1501338 | TAR-T37345 | 5,7-Dihydroxycoumarin | TargetMol | |
| 1501337 | TAR-T37343 | Lysozyme | TargetMol | |
| 1501336 | TAR-T37342 | N-butyryl-L-Homocysteine thiolactone | TargetMol | |
| 1501335 | TAR-T37341 | N-Acetyltyramine | TargetMol | |
| 1501334 | TAR-T37337 | N-3-oxo-hexadecanoyl-L-Homoserine lactone | TargetMol | |
| 1501333 | TAR-T37331 | Pyrrophenone | TargetMol | |
| 1501332 | TAR-T37329 | PROTAC IDO1 Degrader-1 | TargetMol | |
| 1501331 | TAR-T37325 | Lodenafil carbonate | TargetMol | |
| 1501330 | TAR-T37324 | Sucrose hexasulfate (potassium salt) | TargetMol | |
| 1501329 | TAR-T37311 | Dichloroiodomethane | TargetMol | |
| 1501328 | TAR-T37310 | Diadenosine pentaphosphate pentasodium | TargetMol | |
| 1501327 | TAR-T37309 | Diadenosine pentaphosphate pentaammonium | TargetMol | |
| 1501326 | TAR-T37308 | Desmethylene Paroxetine (hydrochloride) | TargetMol | |
| 1501325 | TAR-T37300 | PCTR1 | TargetMol | |
| 1501324 | TAR-T37299 | L-Palmitoylcarnitine chloride | TargetMol | |
| 1501323 | TAR-T37294 | GoSlo-SR-5-69 | TargetMol | |
| 1501322 | TAR-T37288 | Remisporine B | TargetMol | |
| 1501321 | TAR-T37287 | Enpatoran hydrochloride | TargetMol | |
| 1501320 | TAR-T37280 | 1-Oleoyl-2-hydroxy-sn-glycero-3-PE | TargetMol | |
| 1501319 | TAR-T37259 | 14(S)-HDHA | TargetMol | |
| 1501318 | TAR-T37258 | 13-methyl Myristic Acid methyl ester | TargetMol | |
| 1501317 | TAR-T37254 | Rugulotrosin A | TargetMol | |
| 1501316 | TAR-T3723 | Dioxopromethazine hydrochloride | TargetMol | |
| 1501315 | TAR-T37221 | GK187 | TargetMol | |
| 1501314 | TAR-T37217 | N-Decanoyl p-Nitroaniline | TargetMol | |
| 1501313 | TAR-T37216 | N-Arachidonoyl-L-Alanine | TargetMol | |
| 1501312 | TAR-T37215 | 5 α,6β-Dihydroxycholestanol | TargetMol | |
| 1501311 | TAR-T37210 | 5-hydroxy Indomethacin | TargetMol | |
| 1501310 | TAR-T3721 | Avitinib maleate | TargetMol | |
| 1501309 | TAR-T37190 | L-Allylglycine | TargetMol | |
| 1501308 | TAR-T37188 | BTC AM | TargetMol | |
| 1501307 | TAR-T37187 | D-erythro/L-threo Lysosphingomyelin (d18:1) | TargetMol | |
| 1501306 | TAR-T37186 | D-(-)-Citramalic Acid (lithium salt) | TargetMol | |
| 1501305 | TAR-T37182 | AX 048 | TargetMol | |
| 1501304 | TAR-T37176 | Edoxaban impurity 6 | TargetMol | |
| 1501303 | TAR-T37175 | Edoxaban impurity 4 | TargetMol | |
| 1501302 | TAR-T37174 | SARS-CoV MPro-IN-1 | TargetMol | |
| 1501301 | TAR-T37170 | N1-Acetylspermidine hydrochloride | TargetMol | |
| 1501300 | TAR-T3716L | Rolapitant free base | TargetMol | |
| 1501299 | TAR-T37168 | Resolvin D1 methyl ester | TargetMol | |
| 1501298 | TAR-T37167 | Reduced Haloperidol | TargetMol | |
| 1501297 | TAR-T37149 | Carbamazepine 10,11-epoxide | TargetMol | |
| 1501296 | TAR-T3714 | SUN11602 | TargetMol | |
| 1501295 | TAR-T37131 | MS 15203 | TargetMol | |
| 1501294 | TAR-T37130 | MRTX1133 formic | TargetMol | |
| 1501293 | TAR-T37123 | 1,2-Dioctanoyl PC | TargetMol | |
| 1501292 | TAR-T37121 | 1,2-bis(heptanoylthio) Glycerophosphocholine | TargetMol | |
| 1501291 | TAR-T37120 | 1,2,3-Triundecanoyl Glycerol | TargetMol | |
| 1501290 | TAR-T37110 | Biotin-Substance P | TargetMol | |
| 1501289 | TAR-T37109 | BIM-23190 hydrochloride | TargetMol | |
| 1501288 | TAR-T37098 | Chk1-IN-5 | TargetMol | |
| 1501287 | TAR-T37095 | Quin-2 (potassium salt) | TargetMol | |
| 1501286 | TAR-T37094 | (S)-UFR2709 hydrochloride | TargetMol | |
| 1501285 | TAR-T37084 | TL13-22 | TargetMol | |
| 1501284 | TAR-T37083 | TL13-110 | TargetMol | |
| 1501283 | TAR-T3708 | BP-1-102 | TargetMol | |
| 1501282 | TAR-T37079 | VEGFR2 Kinase Inhibitor II | TargetMol | |
| 1501281 | TAR-T37077 | Syk-IN-4 | TargetMol | |
| 1501280 | TAR-T37075 | CB2R PAM | TargetMol | |
| 1501279 | TAR-T37073 | LP 12 hydrochloride | TargetMol | |
| 1501278 | TAR-T37070 | Pyridomycin | TargetMol | |
| 1501277 | TAR-T3707 | GNE-3511 | TargetMol | |
| 1501276 | TAR-T37056 | D-erythro-MAPP | TargetMol | |
| 1501275 | TAR-T37052 | Tetranactin | TargetMol | |
| 1501274 | TAR-T37049 | monoMICAAc | TargetMol | |
| 1501273 | TAR-T37046 | 1-Methyl-1,4-dihydronicotinamide | TargetMol | |
| 1501272 | TAR-T37041 | MD-222 | TargetMol | |
| 1501271 | TAR-T37037 | Vinflunine ditartrate | TargetMol | |
| 1501270 | TAR-T37035 | HAPC-Chol | TargetMol | |
| 1501269 | TAR-T37031 | Quinacrine mustard (hydrochloride) | TargetMol | |
| 1501268 | TAR-T37020 | Endosidin-2 | TargetMol | |
| 1501267 | TAR-T37016 | Iralukast (CGP 45715A) | TargetMol | |
| 1501266 | TAR-T37014 | Inupadenant | TargetMol | |
| 1501265 | TAR-T37008 | Reveromycin A | TargetMol | |
| 1501264 | TAR-T36996 | MSA-2 dimer | TargetMol | |
| 1501263 | TAR-T36990 | Moenomycin Complex | TargetMol | |
| 1501262 | TAR-T3699 | Bay 59-3074 | TargetMol | |
| 1501261 | TAR-T36989 | N-3-hydroxydecanoyl-DL-Homoserine lactone | TargetMol | |
| 1501260 | TAR-T36987 | N,N-dimethyl Sphinganine (d18:0) | TargetMol | |
| 1501259 | TAR-T36978 | AS-99 TFA | TargetMol | |
| 1501258 | TAR-T36976 | SGC 6870 | TargetMol | |
| 1501257 | TAR-T36975 | SETD2-IN-1 TFA | TargetMol | |
| 1501256 | TAR-T36974 | D-threo-PPMP hydrochloride | TargetMol | |
| 1501255 | TAR-T36973 | 5-Phospho-D-ribose 1-diphosphate (sodium salt hydrate) | TargetMol | |
| 1501254 | TAR-T36971 | 5-Ethynyluridine | TargetMol | |
| 1501252 | TAR-T36967 | LSN3106729 hydrochloride | TargetMol | |
| 1501251 | TAR-T36964 | BML-259 | TargetMol | |
| 1501249 | TAR-T36954 | Nemorosone | TargetMol | |
| 1501248 | TAR-T36953 | Naphthofluorescein | TargetMol | |
| 1501247 | TAR-T3694L | Tebanicline tosylate | TargetMol | |
| 1501246 | TAR-T36948 | NIAD-4 | TargetMol | |
| 1501245 | TAR-T36945 | Cetirizine Impurity C | TargetMol | |
| 1501244 | TAR-T36944 | Ara-G | TargetMol | |
| 1501243 | TAR-T36941 | Sporidesmolide III | TargetMol | |
| 1501242 | TAR-T36940 | Spiroxamine | TargetMol | |
| 1501241 | TAR-T36935 | PKUMDL-LC-101-D04 | TargetMol | |
| 1501240 | TAR-T36932 | CD532 hydrochloride | TargetMol | |
| 1501239 | TAR-T36927 | Hydrocortisone phosphate | TargetMol | |
| 1501236 | TAR-T36911 | Pramlintide (acetate hydrate) | TargetMol | |
| 1501235 | TAR-T36905 | Nanangenine F | TargetMol | |
| 1501234 | TAR-T3690 | A-740003 | TargetMol | |
| 1501233 | TAR-T3689L | Ruboxistaurin mesylate | TargetMol | |
| 1501232 | TAR-T36899 | INCB086550 | TargetMol | |
| 1501231 | TAR-T36893 | 4-oxo Withaferin A | TargetMol | |
| 1501230 | TAR-T36891 | MRIA9 | TargetMol | |
| 1501229 | TAR-T3689 | Ruboxistaurin hydrochloride | TargetMol | |
| 1501228 | TAR-T36886 | Pestalotin | TargetMol | |
| 1501227 | TAR-T36884 | BM-1244 | TargetMol | |
| 1501226 | TAR-T36879L | H-Leu-Leu-OMe . HBr | TargetMol | |
| 1501225 | TAR-T36870 | 5,6-dihydro-5-Fluorouracil | TargetMol | |
| 1501224 | TAR-T36846 | Chromomycin A2 | TargetMol | |
| 1501223 | TAR-T36843 | ICAAc | TargetMol | |
| 1501222 | TAR-T36840 | (R)-Omeprazole (sodium salt) | TargetMol | |
| 1501221 | TAR-T36838 | (R)-Bromoenol lactone | TargetMol | |
| 1501220 | TAR-T36833 | A6770 | TargetMol | |
| 1501219 | TAR-T36831 | 9-Oxononanoic Acid | TargetMol | |
| 1501217 | TAR-T36826 | Acetaminophen Glucuronide (sodium salt) | TargetMol | |
| 1501216 | TAR-T36825 | Aceclofenac methyl ester | TargetMol | |
| 1501215 | TAR-T36824 | Aceclofenac ethyl ester | TargetMol | |
| 1501214 | TAR-T36817 | Quadrone | TargetMol | |
| 1501213 | TAR-T36812 | Linoleic Acid Amide | TargetMol | |
| 1501212 | TAR-T36810 | uPSEM 792 hydrochloride | TargetMol | |
| 1501211 | TAR-T36808 | UK 59811 hydrochloride | TargetMol | |
| 1501210 | TAR-T36807 | Estradiol 17-(β-D-Glucuronide) (sodium salt hydrate) | TargetMol | |
| 1501209 | TAR-T36806 | TPC2-A1-P | TargetMol | |
| 1501208 | TAR-T36802 | Bisubstrate Inhibitor 78 | TargetMol | |
| 1501207 | TAR-T36798 | SW2_110A | TargetMol | |
| 1501206 | TAR-T36797 | 1-Alaninechlamydocin | TargetMol | |
| 1501205 | TAR-T36794 | Dolutegravir O-β-D-Glucuronide | TargetMol | |
| 1501204 | TAR-T36784 | Filipin II | TargetMol | |
| 1501203 | TAR-T36783 | BPIQ-II (hydrochloride) | TargetMol | |
| 1501202 | TAR-T36782 | TAK1-IN-2 | TargetMol | |
| 1501201 | TAR-T36778 | MK2-IN-1 | TargetMol | |
| 1501200 | TAR-T36766 | Palmitoylcholine (chloride) | TargetMol | |
| 1501199 | TAR-T36764 | PAF C-18:1 | TargetMol | |
| 1501198 | TAR-T36758 | CAIX Inhibitor S4 | TargetMol | |
| 1501196 | TAR-T36740 | Guanosine 5?-diphosphate (sodium salt hydrate) | TargetMol | |
| 1501194 | TAR-T36733 | HLI373 dihydrochloride | TargetMol | |
| 1501193 | TAR-T36732 | Ciprostene (calcium salt) | TargetMol | |
| 1501190 | TAR-T36718 | Tie2 Inhibitor 7 | TargetMol | |
| 1501189 | TAR-T36717 | RWJ-56110 dihydrochloride | TargetMol | |
| 1501188 | TAR-T36716 | RO0270608 | TargetMol | |
| 1501186 | TAR-T36709 | N?-Nitrosonornicotine | TargetMol | |
| 1501185 | TAR-T36708 | Monohydroxy Melphalan (hydrochloride) | TargetMol | |
| 1501184 | TAR-T36704 | CCT241533 dihydrochloride | TargetMol | |
| 1501183 | TAR-T36701 | Phosphoramide mustard (cyclohexanamine) | TargetMol | |
| 1501181 | TAR-T36699 | 9-Methoxyellipticine | TargetMol | |
| 1501180 | TAR-T36695 | TAS-103 | TargetMol | |
| 1501179 | TAR-T36686 | Ac-Arg-Gly-Lys(Ac)-AMC | TargetMol | |
| 1501178 | TAR-T36684 | Ipivivint | TargetMol | |
| 1501176 | TAR-T36671 | C2 Phytoceramide (t18:0/2:0) | TargetMol | |
| 1501175 | TAR-T36669 | IYPTNGYTR acetate | TargetMol | |
| 1501174 | TAR-T36663 | Decanoyl-L-carnitine (chloride) | TargetMol | |
| 1501173 | TAR-T36659 | Boromycin | TargetMol | |
| 1501172 | TAR-T36650 | Ansatrienin B | TargetMol | |
| 1501170 | TAR-T36648 | Tucatinib hemiethanolate | TargetMol | |
| 1501168 | TAR-T36643 | PKI-166 hydrochloride | TargetMol | |
| 1501167 | TAR-T36642 | RAS/RAS-RAF-IN-1 | TargetMol | |
| 1501166 | TAR-T3664 | THZ1 | TargetMol | |
| 1501165 | TAR-T36632 | BB-Cl-Yne | TargetMol | |
| 1501164 | TAR-T36630 | MRTX9768 hydrochloride | TargetMol | |
| 1501163 | TAR-T36629 | Givinostat | TargetMol | |
| 1501162 | TAR-T36625 | LSD1/HDAC6-IN-1 | TargetMol | |
| 1501161 | TAR-T36624 | α-Hydroxyglutaric Acid | TargetMol | |
| 1501160 | TAR-T36622 | Angiotensin I/II (1-6) (TFA) | TargetMol | |
| 1501158 | TAR-T36619 | Aligeron | TargetMol | |
| 1501157 | TAR-T36618 | Rupatadine | TargetMol | |
| 1501156 | TAR-T36612 | Deoxyenterocin | TargetMol | |
| 1501155 | TAR-T36598 | Enopeptin A | TargetMol | |
| 1501154 | TAR-T36593 | TEI-9648 | TargetMol | |
| 1501153 | TAR-T36592 | Impurity of Calcipotriol | TargetMol | |
| 1501152 | TAR-T3659 | Zorifertinib | TargetMol | |
| 1501151 | TAR-T36584 | HNMPA-(AM)3 | TargetMol | |
| 1501150 | TAR-T36574 | GW841819X | TargetMol | |
| 1501149 | TAR-T36572 | N6-Methyladenine | TargetMol | |
| 1501148 | TAR-T36567 | DPPP | TargetMol | |
| 1501147 | TAR-T36543 | Prostaglandin B2 | TargetMol | |
| 1501146 | TAR-T36541 | Nornidulin | TargetMol | |
| 1501145 | TAR-T36540 | Nodusmicin | TargetMol | |
| 1501144 | TAR-T36533 | SCH 725674 | TargetMol | |
| 1501143 | TAR-T36532 | SCH 38519 | TargetMol | |
| 1501142 | TAR-T36527 | IL-4-inhibitor-1 | TargetMol | |
| 1501141 | TAR-T36526 | IL-17 modulator 4 | TargetMol | |
| 1501140 | TAR-T36525 | IL-17 modulator 1 disodium | TargetMol | |
| 1501139 | TAR-T36522 | Isoallolithocholic acid | TargetMol | |
| 1501138 | TAR-T3652 | KRIBB11 | TargetMol | |
| 1501137 | TAR-T36512 | PTIO | TargetMol | |
| 1501136 | TAR-T36504 | STY-BODIPY | TargetMol | |
| 1501135 | TAR-T36501 | CYPMPO | TargetMol | |
| 1501134 | TAR-T36500 | Cyanidin 3-O-arabinoside | TargetMol | |
| 1501133 | TAR-T36499 | CuATSM | TargetMol | |
| 1501132 | TAR-T36494 | Conglobatin | TargetMol | |
| 1501131 | TAR-T36491 | POMHEX | TargetMol | |
| 1501130 | TAR-T36485 | Becatecarin | TargetMol | |
| 1501129 | TAR-T3647 | HTHQ | TargetMol | |
| 1501128 | TAR-T36469 | Atrazine Mercapturate | TargetMol | |
| 1501127 | TAR-T36468 | ARN14988 | TargetMol | |
| 1501126 | TAR-T36467 | Chrysomycin A | TargetMol | |
| 1501125 | TAR-T36459 | CAY10730 | TargetMol | |
| 1501124 | TAR-T36456 | 12-hydroxy Stearic Acid | TargetMol | |
| 1501123 | TAR-T36453 | 1-Myristoyl-2-hydroxy-sn-glycero-3-PE | TargetMol | |
| 1501122 | TAR-T36451 | 1,2-Dipalmitoyl-sn-glycero-3-PE-N-(cap biotin) (sodium salt) | TargetMol | |
| 1501121 | TAR-T36445 | Neuropeptide Y (3-36) (human, rat) | TargetMol | |
| 1501120 | TAR-T36441 | Contezolid acefosamil sodium | TargetMol | |
| 1501119 | TAR-T36425 | Duclauxin | TargetMol | |
| 1501118 | TAR-T36411 | 9-Ethylguanine | TargetMol | |
| 1501117 | TAR-T36401 | DCVC | TargetMol | |
| 1501116 | TAR-T36399 | PAO-Nap | TargetMol | |
| 1501115 | TAR-T36397 | TAN 420E | TargetMol | |
| 1501114 | TAR-T36385 | Ansatrienin A | TargetMol | |
| 1501113 | TAR-T3637 | Pifithrin-β hydrobromide | TargetMol | |
| 1501112 | TAR-T36369 | 3,6-diacetoxy Phthalonitrile | TargetMol | |
| 1501111 | TAR-T36367 | RK-682 (calcium salt) | TargetMol | |
| 1501110 | TAR-T36352 | Suc-Leu-Tyr-AMC | TargetMol | |
| 1501109 | TAR-T3635 | IQ 1 | TargetMol | |
| 1501108 | TAR-T36344 | Ac-LEVD-AFC | TargetMol | |
| 1501107 | TAR-T3634 | Osimertinib mesylate | TargetMol | |
| 1501106 | TAR-T36338 | AAF-CMK (trifluoroacetate salt) | TargetMol | |
| 1501105 | TAR-T36332 | Z-DEVD-AFC | TargetMol | |
| 1501104 | TAR-T36330 | Terrecyclic Acid | TargetMol | |
| 1501103 | TAR-T36317 | SM-1295 | TargetMol | |
| 1501102 | TAR-T36316 | mTOR inhibitor-8 | TargetMol | |
| 1501101 | TAR-T36313 | QL-IX-55 | TargetMol | |
| 1501100 | TAR-T3631 | PF-8380 | TargetMol | |
| 1501099 | TAR-T36298 | Tyrocidine Complex | TargetMol | |
| 1501098 | TAR-T36293 | PAR 4 (1-6) | TargetMol | |
| 1501097 | TAR-T36292 | NSC 12 | TargetMol | |
| 1501096 | TAR-T36289 | Protease-Activated Receptor-3 (PAR-3) (1-6), human TFA | TargetMol | |
| 1501095 | TAR-T36286 | Protease-Activated Receptor-3 (PAR-3) (1-6), human | TargetMol | |
| 1501094 | TAR-T3628 | Madrasin | TargetMol | |
| 1501093 | TAR-T3627 | IQ-1S free acid | TargetMol | |
| 1501092 | TAR-T36260 | NR 7h | TargetMol | |
| 1501091 | TAR-T36254 | dTAGV-1 hydrochloride | TargetMol | |
| 1501090 | TAR-T36253 | dTAGV-1 | TargetMol | |
| 1501089 | TAR-T36252 | dTAG-13-NEG | TargetMol | |
| 1501088 | TAR-T3625 | Bempedoic acid | TargetMol | |
| 1501086 | TAR-T36247 | TBK1 control PROTAC? 4 | TargetMol | |
| 1501085 | TAR-T36246 | SJF 8240 | TargetMol | |
| 1501084 | TAR-T36245 | SJF 1528 | TargetMol | |
| 1501083 | TAR-T36244 | SJF 1521 | TargetMol | |
| 1501082 | TAR-T36243 | PROTAC RIPK degrader-6 | TargetMol | |
| 1501081 | TAR-T36236 | 5-cis Carbaprostacyclin | TargetMol | |
| 1501080 | TAR-T36230 | C2 Ceramide (d14:1/2:0) | TargetMol | |
| 1501079 | TAR-T36227 | Beauveriolide III | TargetMol | |
| 1501078 | TAR-T36221 | 2-chloro Palmitic Acid | TargetMol | |
| 1501077 | TAR-T36212 | 16(S)-Iloprost | TargetMol | |
| 1501076 | TAR-T36211 | 16(R)-Iloprost | TargetMol | |
| 1501075 | TAR-T3621 | Brigatinib | TargetMol | |
| 1501074 | TAR-T36207 | Methylspinazarin | TargetMol | |
| 1501073 | TAR-T36202 | Citreoindole | TargetMol | |
| 1501072 | TAR-T36201 | AZD5582 dihydrochloride | TargetMol | |
| 1501071 | TAR-T36188 | Ceramide Phosphoethanolamines (bovine) | TargetMol | |
| 1501070 | TAR-T36187 | Celecoxib Carboxylic Acid | TargetMol | |
| 1501069 | TAR-T36182 | Neamine tetrahydrochloride | TargetMol | |
| 1501068 | TAR-T36181 | Quinaldopeptin | TargetMol | |
| 1501067 | TAR-T36171 | KDdiA-PC | TargetMol | |
| 1501066 | TAR-T36169 | 15-LOX-1 inhibitor 1 | TargetMol | |
| 1501065 | TAR-T36141 | Boscalid | TargetMol | |
| 1501064 | TAR-T36139 | BMS-795311 | TargetMol | |
| 1501063 | TAR-T36137 | Biotin (S)-sulfoxide | TargetMol | |
| 1501062 | TAR-T36136 | Biotin (R)-Sulfoxide | TargetMol | |
| 1501061 | TAR-T36125 | Tienilic Acid | TargetMol | |
| 1501060 | TAR-T36117 | 3-Deoxy-D-glycero-D-galacto-2-nonulosonic Acid | TargetMol | |
| 1501059 | TAR-T36115 | Colchicoside | TargetMol | |
| 1501058 | TAR-T36108 | YW3-56 (hydrochloride) (technical grade) | TargetMol | |
| 1501057 | TAR-T36107 | YW3-56 | TargetMol | |
| 1501056 | TAR-T36101 | Psychotridine | TargetMol | |
| 1501055 | TAR-T3610 | Ranitidine | TargetMol | |
| 1501054 | TAR-T36097 | TNF- α-IN-2 | TargetMol | |
| 1501053 | TAR-T36094 | Herbicidin A | TargetMol | |
| 1501052 | TAR-T36091 | LEESGGGLVQPGGSMK acetate | TargetMol | |
| 1501051 | TAR-T36087 | PI3K-IN-22 | TargetMol | |
| 1501050 | TAR-T36080 | Rivenprost | TargetMol | |
| 1501049 | TAR-T36078 | D-Xylofuranose, 1,2,3,5-tetraacetate | TargetMol | |
| 1501048 | TAR-T36068 | Brevetoxin B | TargetMol | |
| 1501047 | TAR-T36063 | N-desmethyl Zolmitriptan | TargetMol | |
| 1501046 | TAR-T36055 | Nitisinone-13C6 | TargetMol | |
| 1501045 | TAR-T36049 | Linearmycin B | TargetMol | |
| 1501044 | TAR-T36048 | Linearmycin A | TargetMol | |
| 1501043 | TAR-T36037 | CBR-470-2 | TargetMol | |
| 1501042 | TAR-T36032 | Desotamide | TargetMol | |
| 1501041 | TAR-T36031 | Desmethyl Ofloxacin (hydrochloride) | TargetMol | |
| 1501040 | TAR-T36025 | Deoxyviolacein | TargetMol | |
| 1501039 | TAR-T36020 | Florfenicol amine (hydrochloride) | TargetMol | |
| 1501038 | TAR-T36011 | p38 MAP Kinase Inhibitor IV | TargetMol | |
| 1501037 | TAR-T36010 | p38 MAPK Inhibitor | TargetMol | |
| 1501036 | TAR-T36008 | Nebentan potassium | TargetMol | |
| 1501035 | TAR-T36007 | Nebentan | TargetMol | |
| 1501033 | TAR-T35996 | FeTPPS | TargetMol | |
| 1501032 | TAR-T35994 | Erastin2 | TargetMol | |
| 1501031 | TAR-T35989 | CAY10565 | TargetMol | |
| 1501030 | TAR-T35988 | CAY10564 | TargetMol | |
| 1501029 | TAR-T35987 | CAY10563 | TargetMol | |
| 1501028 | TAR-T35982 | Capsorubin | TargetMol | |
| 1501027 | TAR-T35981 | Biliverdin (hydrochloride) | TargetMol | |
| 1501026 | TAR-T35976 | 6-Formylpterin | TargetMol | |
| 1501025 | TAR-T35974 | 5-methyl-2-HOBA (hydrochloride) | TargetMol | |
| 1501024 | TAR-T35970 | 4-hydroxy Nonenal Alkyne | TargetMol | |
| 1501023 | TAR-T35969 | NOC-5 | TargetMol | |
| 1501022 | TAR-T35964 | MitoTEMPO hydrate | TargetMol | |
| 1501021 | TAR-T3596 | TB5 | TargetMol | |
| 1501020 | TAR-T35955 | PAR2 (1-6) amide (human) (trifluoroacetate salt) | TargetMol | |
| 1501019 | TAR-T35953 | all-trans-Anhydro Retinol | TargetMol | |
| 1501018 | TAR-T35951 | Alkaline Phosphatase | TargetMol | |
| 1501017 | TAR-T35943 | 15(S)-HpETE | TargetMol | |
| 1501016 | TAR-T35929 | O-Demethyl Apremilast | TargetMol | |
| 1501015 | TAR-T35911 | Piliformic Acid | TargetMol | |
| 1501014 | TAR-T35910 | Petromurin C | TargetMol | |
| 1501013 | TAR-T3591 | URB602 | TargetMol | |
| 1501012 | TAR-T35909 | Penicinoline | TargetMol | |
| 1501011 | TAR-T35908 | Paraherquamide E | TargetMol | |
| 1501010 | TAR-T35907 | Paraherquamide A | TargetMol | |
| 1501009 | TAR-T35893 | rac-1,2-bis-Palmitoyl-3-chloropropanediol | TargetMol | |
| 1501008 | TAR-T35891 | pyCTZ TFA | TargetMol | |
| 1501007 | TAR-T35889 | PB2 | TargetMol | |
| 1501006 | TAR-T35886 | L-hydroxy Arginine (acetate) | TargetMol | |
| 1501005 | TAR-T35881 | Resolvin E2 | TargetMol | |
| 1501004 | TAR-T3588 | JK184 | TargetMol | |
| 1501003 | TAR-T35867 | TRAP-6 Peptide (trifluoroacetate salt) | TargetMol | |
| 1501002 | TAR-T35862 | Cucurbit[8]uril | TargetMol | |
| 1501001 | TAR-T35857 | Actinopyrone A | TargetMol | |
| 1501000 | TAR-T3585 | TMS | TargetMol | |
| 1500999 | TAR-T35841 | 5-Benzyloxygramine | TargetMol | |
| 1500998 | TAR-T35834 | (Sar1)-Angiotensin II | TargetMol | |
| 1500997 | TAR-T35829 | CC-90005 | TargetMol | |
| 1500996 | TAR-T35825 | Trichostatin C | TargetMol | |
| 1500995 | TAR-T35824 | Trapoxin A | TargetMol | |
| 1500993 | TAR-T35817 | Photoswitchable PAD Inhibitor (technical grade) | TargetMol | |
| 1500992 | TAR-T35811 | CAY10410 | TargetMol | |
| 1500991 | TAR-T35810 | C24 dihydro Ceramide (d18:0/24:0) | TargetMol | |
| 1500990 | TAR-T3580L | FIPI HCl | TargetMol | |
| 1500989 | TAR-T35808 | C18:1 Ceramide (d18:1/18:1(9Z)) | TargetMol | |
| 1500988 | TAR-T35807 | C18 dihydro Ceramide (d18:0/18:0) | TargetMol | |
| 1500987 | TAR-T35806 | C18 Ceramide (d18:1/18:0) | TargetMol | |
| 1500986 | TAR-T35797 | Lithocholic Acid 3-sulfate (sodium salt) | TargetMol | |
| 1500985 | TAR-T35795 | Lactisole | TargetMol | |
| 1500984 | TAR-T35793 | JMV3002 | TargetMol | |
| 1500983 | TAR-T3578L | Pyridoxal calcium phosphate | TargetMol | |
| 1500982 | TAR-T35786 | O-7460 | TargetMol | |
| 1500981 | TAR-T35776 | Janthitrem A | TargetMol | |
| 1500980 | TAR-T35768 | GSK-J5 hydrochloride | TargetMol | |
| 1500978 | TAR-T35759 | Cardol triene | TargetMol | |
| 1500977 | TAR-T35756 | Avermectin B1a monosaccharide | TargetMol | |
| 1500976 | TAR-T35755 | Avermectin B1a aglycone | TargetMol | |
| 1500975 | TAR-T35754 | Aszonapyrone A | TargetMol | |
| 1500974 | TAR-T35748 | Tetromycin B | TargetMol | |
| 1500973 | TAR-T35745 | Marcfortine A | TargetMol | |
| 1500972 | TAR-T35743 | Ivermectin B1a aglycone | TargetMol | |
| 1500971 | TAR-T35742 | IKD-8344 | TargetMol | |
| 1500970 | TAR-T35738 | Eprinomectin B1b | TargetMol | |
| 1500969 | TAR-T35736 | Drimentine B | TargetMol | |
| 1500968 | TAR-T35735 | Drimentine A | TargetMol | |
| 1500967 | TAR-T35734 | Doramectin monosaccharide | TargetMol | |
| 1500966 | TAR-T35733 | Doramectin aglycone | TargetMol | |
| 1500965 | TAR-T35732 | Diacetylcercosporin | TargetMol | |
| 1500964 | TAR-T35731 | Deethylindanomycin | TargetMol | |
| 1500963 | TAR-T35729 | Nemadipine-A | TargetMol | |
| 1500962 | TAR-T35726 | 4-hydroxy Xylazine | TargetMol | |
| 1500961 | TAR-T35725 | 4-hydroxy Valsartan | TargetMol | |
| 1500960 | TAR-T35723 | GRK-IN-1 | TargetMol | |
| 1500959 | TAR-T3571 | SU5201 | TargetMol | |
| 1500958 | TAR-T35709 | N-acetyl-D-Lactosamine | TargetMol | |
| 1500957 | TAR-T35694 | OD36 | TargetMol | |
| 1500956 | TAR-T3569 | SU5214 | TargetMol | |
| 1500955 | TAR-T35682 | 2-deoxy-2-fluoro-D-Glucose | TargetMol | |
| 1500954 | TAR-T35681 | 2-Amino-3,8-dimethylimidazo-[4,5-f]-quinoxaline | TargetMol | |
| 1500953 | TAR-T35680 | 2-(1-(Thiophen-2-yl)ethylidene)hydrazinecarbothioamide | TargetMol | |
| 1500952 | TAR-T35673 | Stictic Acid | TargetMol | |
| 1500951 | TAR-T35668 | Neoaureothin | TargetMol | |
| 1500950 | TAR-T35650 | Samuraciclib trihydrochloride | TargetMol | |
| 1500949 | TAR-T35648 | 4-Thiouridine | TargetMol | |
| 1500948 | TAR-T35634 | Platensimycin | TargetMol | |
| 1500947 | TAR-T35633 | Pinolenic Acid ethyl ester | TargetMol | |
| 1500946 | TAR-T35630 | bpV(pic) (potassium hydrate) | TargetMol | |
| 1500945 | TAR-T35625 | Aminoacetone (hydrochloride) | TargetMol | |
| 1500944 | TAR-T35624 | Ajoene | TargetMol | |
| 1500943 | TAR-T3562 | Valrocemide | TargetMol | |
| 1500942 | TAR-T35614 | D-Trimannuronic acid | TargetMol | |
| 1500941 | TAR-T35607 | 10'-Desmethoxystreptonigrin | TargetMol | |
| 1500940 | TAR-T35606 | 1,2-Dioleoyl-sn-glycero-3-phospho-L-serine sodium | TargetMol | |
| 1500939 | TAR-T35592 | SB 202190 hydrochloride | TargetMol | |
| 1500938 | TAR-T35590 | Graphislactone A | TargetMol | |
| 1500937 | TAR-T35584 | Hydroxydehydro Nifedipine Carboxylate | TargetMol | |
| 1500936 | TAR-T35581 | Prazobind | TargetMol | |
| 1500935 | TAR-T35575 | Aldehyde Reactive Probe (trifluoroacetate salt) | TargetMol | |
| 1500934 | TAR-T35569 | CTA 056 | TargetMol | |
| 1500933 | TAR-T35566 | RBPJ Inhibitor-1 | TargetMol | |
| 1500931 | TAR-T35564 | PF-07104091 hydrate | TargetMol | |
| 1500930 | TAR-T35563 | PF-5274857 hydrochloride | TargetMol | |
| 1500929 | TAR-T35558 | KAAD-Cyclopamine | TargetMol | |
| 1500928 | TAR-T35555 | GSK-3/CDK5/CDK2-IN-1 | TargetMol | |
| 1500927 | TAR-T3554 | RG14620 | TargetMol | |
| 1500926 | TAR-T35538 | HPI-1 (hydrate) | TargetMol | |
| 1500925 | TAR-T35487 | Anacardic Acid Diene | TargetMol | |
| 1500924 | TAR-T35486 | Amiprofos methyl | TargetMol | |
| 1500923 | TAR-T35484 | 5,7,8-Trimethoxydictamnine | TargetMol | |
| 1500922 | TAR-T35479 | CRBN-6-5-5-VHL | TargetMol | |
| 1500921 | TAR-T35477 | BSJ-Bump | TargetMol | |
| 1500920 | TAR-T35476 | BSJ-04-132 | TargetMol | |
| 1500919 | TAR-T35475 | aTAG 4531 | TargetMol | |
| 1500918 | TAR-T35474 | aTAG 2139 | TargetMol | |
| 1500917 | TAR-T3546 | STO-609 | TargetMol | |
| 1500916 | TAR-T35459 | Glycyl H-1152 hydrochloride | TargetMol | |
| 1500915 | TAR-T35448 | 10-Thiastearic Acid | TargetMol | |
| 1500914 | TAR-T3544 | SHP099 hydrochloride | TargetMol | |
| 1500913 | TAR-T35423 | 7-oxo Staurosporine | TargetMol | |
| 1500912 | TAR-T35421 | 2'-O-Succinyl-cAMP | TargetMol | |
| 1500911 | TAR-T35415 | α-D-Glucose-1,6-bisphosphate (potassium salt hydrate) | TargetMol | |
| 1500910 | TAR-T35412 | (+)-JQ-1-aldehyde | TargetMol | |
| 1500909 | TAR-T35411 | (+)-Biotin 4-Amidobenzoic Acid (sodium salt) | TargetMol | |
| 1500908 | TAR-T35399 | BM213 | TargetMol | |
| 1500906 | TAR-T35393 | gp91ds-tat | TargetMol | |
| 1500903 | TAR-T35374 | (Ala13)-Apelin-13 | TargetMol | |
| 1500902 | TAR-T35373 | Bulevirtide (Myrcludex B) | TargetMol | |
| 1500901 | TAR-T35371 | Colesevelam Hydrochloride | TargetMol | |
| 1500900 | TAR-T35370 | MEISi-2 Dihydrochloride | TargetMol | |
| 1500899 | TAR-T35367 | Thioacetamide | TargetMol | |
| 1500898 | TAR-T35361 | AST5902 trimesylate | TargetMol | |
| 1500896 | TAR-T35342 | MELK-8a Dihydrochloride | TargetMol | |
| 1500895 | TAR-T3534 | Tetrabenazine Racemate | TargetMol | |
| 1500894 | TAR-T35338 | CP2 | TargetMol | |
| 1500893 | TAR-T35337 | Teduglutide | TargetMol | |
| 1500892 | TAR-T35334 | CH7233163 | TargetMol | |
| 1500891 | TAR-T3533 | Apilimod mesylate | TargetMol | |
| 1500890 | TAR-T35323 | ZYZ-803 | TargetMol | |
| 1500889 | TAR-T35322 | Zytron | TargetMol | |
| 1500888 | TAR-T35320 | Zygosporin D | TargetMol | |
| 1500887 | TAR-T35319 | Zy 15109 | TargetMol | |
| 1500886 | TAR-T35318 | Zuretinol | TargetMol | |
| 1500885 | TAR-T35316 | Zometapine | TargetMol | |
| 1500884 | TAR-T35315 | Zoloperone | TargetMol | |
| 1500883 | TAR-T35314 | Zoleprodolol | TargetMol | |
| 1500882 | TAR-T35313 | Zolazepam | TargetMol | |
| 1500881 | TAR-T35312 | ZM-274773 | TargetMol | |
| 1500880 | TAR-T35311 | ZM 260384 | TargetMol | |
| 1500879 | TAR-T35310 | ZM 230487 | TargetMol | |
| 1500878 | TAR-T35309 | ZL004 | TargetMol | |
| 1500877 | TAR-T35308 | Zinc decanoate | TargetMol | |
| 1500876 | TAR-T35307 | Zicronapine | TargetMol | |
| 1500875 | TAR-T35306 | Z-Hpg | TargetMol | |
| 1500873 | TAR-T35304 | Zetidoline | TargetMol | |
| 1500872 | TAR-T35303 | Zephyranthine | TargetMol | |
| 1500871 | TAR-T35302 | Zepastine | TargetMol | |
| 1500870 | TAR-T35301 | ZEP-3 | TargetMol | |
| 1500869 | TAR-T35300 | Zeniplatin | TargetMol | |
| 1500868 | TAR-T35298 | Zelandopam hydrochloride | TargetMol | |
| 1500867 | TAR-T35297 | ZD 0870 | TargetMol | |
| 1500866 | TAR-T35294 | Z-160 hydrochloride | TargetMol | |
| 1500865 | TAR-T35293 | Z-1159-5 | TargetMol | |
| 1500864 | TAR-T35290 | Z 6031 | TargetMol | |
| 1500863 | TAR-T35289 | Z 4212 | TargetMol | |
| 1500862 | TAR-T35288 | Z 300 | TargetMol | |
| 1500861 | TAR-T35287 | Z 2004 | TargetMol | |
| 1500860 | TAR-T35286 | Z 1796 | TargetMol | |
| 1500859 | TAR-T35285 | Yuccagenone | TargetMol | |
| 1500856 | TAR-T35282 | YT 146 | TargetMol | |
| 1500855 | TAR-T35281 | YS 822A | TargetMol | |
| 1500854 | TAR-T35280 | YS 51 | TargetMol | |
| 1500853 | TAR-T3528 | Senicapoc | TargetMol | |
| 1500852 | TAR-T35279 | YS 3646 | TargetMol | |
| 1500851 | TAR-T35278 | YS 3643 | TargetMol | |
| 1500850 | TAR-T35277 | YS 3634 | TargetMol | |
| 1500849 | TAR-T35276 | YS 3621 | TargetMol | |
| 1500848 | TAR-T35275 | YS 3025 | TargetMol | |
| 1500847 | TAR-T35274 | YPH 103 | TargetMol | |
| 1500846 | TAR-T35273 | YPC-22026 | TargetMol | |
| 1500845 | TAR-T35272 | Youlemycin | TargetMol | |
| 1500844 | TAR-T35271 | Yoshi-864 | TargetMol | |
| 1500843 | TAR-T35270 | YO-Pro 1 | TargetMol | |
| 1500842 | TAR-T35269 | Yomogin | TargetMol | |
| 1500840 | TAR-T35267 | Yokonoside | TargetMol | |
| 1500839 | TAR-T35266 | YN 0165 JA | TargetMol | |
| 1500838 | TAR-T35265 | YM-440 | TargetMol | |
| 1500837 | TAR-T35264 | YM-08050 | TargetMol | |
| 1500836 | TAR-T35263 | YM 9429 | TargetMol | |
| 1500835 | TAR-T35262 | YM 534 | TargetMol | |
| 1500834 | TAR-T35261 | YM 26567-1 | TargetMol | |
| 1500833 | TAR-T35260 | YM 22508 | TargetMol | |
| 1500832 | TAR-T3526 | Dasotraline hydrochloride | TargetMol | |
| 1500831 | TAR-T35259 | YM 212 | TargetMol | |
| 1500830 | TAR-T35258 | YM 16638 | TargetMol | |
| 1500829 | TAR-T35257 | YM 16457 | TargetMol | |
| 1500828 | TAR-T35256 | YM 16151-1 | TargetMol | |
| 1500827 | TAR-T35255 | YM 13650 | TargetMol | |
| 1500826 | TAR-T35254 | YM 11133 | TargetMol | |
| 1500825 | TAR-T35253 | YM 11124 | TargetMol | |
| 1500824 | TAR-T35252 | YM 09538 | TargetMol | |
| 1500823 | TAR-T35250 | Yingzhaosu B | TargetMol | |
| 1500822 | TAR-T35249 | YG 19-256 | TargetMol | |
| 1500821 | TAR-T35248 | Yersiniose | TargetMol | |
| 1500820 | TAR-T35246 | Yellamycin C | TargetMol | |
| 1500819 | TAR-T35245 | Yellamycin B | TargetMol | |
| 1500818 | TAR-T35244 | Yellamycin A | TargetMol | |
| 1500817 | TAR-T35242 | YC 170 | TargetMol | |
| 1500816 | TAR-T35241 | YB-11 | TargetMol | |
| 1500815 | TAR-T35240 | Yau 17 | TargetMol | |
| 1500814 | TAR-T35239 | Yanangin | TargetMol | |
| 1500813 | TAR-T35238 | Yanangcorinin | TargetMol | |
| 1500812 | TAR-T35237 | Yamataimine | TargetMol | |
| 1500809 | TAR-T35232 | Y 8845 | TargetMol | |
| 1500808 | TAR-T35231 | Y 590 | TargetMol | |
| 1500807 | TAR-T35230 | Y 36912 | TargetMol | |
| 1500806 | TAR-T35229 | Y 3506 | TargetMol | |
| 1500805 | TAR-T35228 | Y 26611 | TargetMol | |
| 1500804 | TAR-T35227 | Y 25510 | TargetMol | |
| 1500803 | TAR-T35226 | Y 20811 | TargetMol | |
| 1500802 | TAR-T35225 | Y 20024 | TargetMol | |
| 1500801 | TAR-T35224 | Y 20003 | TargetMol | |
| 1500800 | TAR-T35223 | Y 19432 | TargetMol | |
| 1500799 | TAR-T35222 | Y 19018 | TargetMol | |
| 1500798 | TAR-T35221 | Y 18598 | TargetMol | |
| 1500797 | TAR-T35220 | Y 14556 | TargetMol | |
| 1500796 | TAR-T3522 | Tosufloxacin tosilate | TargetMol | |
| 1500795 | TAR-T35219 | Y 12896 | TargetMol | |
| 1500794 | TAR-T35218 | Y 05460M-A | TargetMol | |
| 1500793 | TAR-T35217 | Xysmalorin | TargetMol | |
| 1500791 | TAR-T35215 | Xymedon | TargetMol | |
| 1500790 | TAR-T35213 | Xylyl isothiocyanate | TargetMol | |
| 1500789 | TAR-T35212 | Xylure | TargetMol | |
| 1500788 | TAR-T35211 | Xylulose | TargetMol | |
| 1500787 | TAR-T35210 | Xyloxemine | TargetMol | |
| 1500786 | TAR-T35209 | Xylotubercidin | TargetMol | |
| 1500785 | TAR-T35208 | Xylosylserine | TargetMol | |
| 1500784 | TAR-T35207 | Xylosucrose | TargetMol | |
| 1500783 | TAR-T35206 | Xylostasine | TargetMol | |
| 1500782 | TAR-T35205 | Xylosmacin | TargetMol | |
| 1500781 | TAR-T35204 | Xyloside | TargetMol | |
| 1500780 | TAR-T35202 | Xylomollin | TargetMol | |
| 1500779 | TAR-T35201 | Xylocytidine | TargetMol | |
| 1500778 | TAR-T35200 | Xylocoumarol | TargetMol | |
| 1500777 | TAR-T3520 | Setipiprant | TargetMol | |
| 1500776 | TAR-T35199 | Xylocholine | TargetMol | |
| 1500775 | TAR-T35198 | Xylenediamine | TargetMol | |
| 1500774 | TAR-T35197 | Xylazole | TargetMol | |
| 1500773 | TAR-T35196 | Xylamine | TargetMol | |
| 1500772 | TAR-T35195 | Xylamidine | TargetMol | |
| 1500771 | TAR-T35194 | Xylachlor | TargetMol | |
| 1500770 | TAR-T35193 | XV638 | TargetMol | |
| 1500769 | TAR-T35192 | XV 459 | TargetMol | |
| 1500768 | TAR-T35191 | XV 076 | TargetMol | |
| 1500767 | TAR-T35190 | Xuelianlactone | TargetMol | |
| 1500766 | TAR-T35189 | XRD 489 | TargetMol | |
| 1500765 | TAR-T35188 | XR 808 | TargetMol | |
| 1500764 | TAR-T35187 | XR 5944 | TargetMol | |
| 1500763 | TAR-T35186 | XR 334 | TargetMol | |
| 1500762 | TAR-T35185L | Xorphanol mesylate | TargetMol | |
| 1500761 | TAR-T35185 | Xorphanol | TargetMol | |
| 1500760 | TAR-T35184L | Xipranolol hydrochloride | TargetMol | |
| 1500759 | TAR-T35184 | Xipranolol | TargetMol | |
| 1500758 | TAR-T35183 | Xinomiline | TargetMol | |
| 1500757 | TAR-T35182 | Xinidamine | TargetMol | |
| 1500756 | TAR-T35181 | Xinchaunling | TargetMol | |
| 1500755 | TAR-T35180 | Ximoprofen | TargetMol | |
| 1500754 | TAR-T35179 | Xilobam | TargetMol | |
| 1500753 | TAR-T35178 | Xidecaflur | TargetMol | |
| 1500752 | TAR-T35177 | Xibornol | TargetMol | |
| 1500751 | TAR-T35176 | Xibenolol | TargetMol | |
| 1500750 | TAR-T35175 | Xestoquinone | TargetMol | |
| 1500749 | TAR-T35174 | Xerantholide | TargetMol | |
| 1500748 | TAR-T35173 | Xeranthin | TargetMol | |
| 1500747 | TAR-T35172 | Xenytropium bromide | TargetMol | |
| 1500746 | TAR-T35171 | Xenytropium | TargetMol | |
| 1500745 | TAR-T35170 | Xenysalate | TargetMol | |
| 1500744 | TAR-T35169 | Xenyhexenic acid | TargetMol | |
| 1500743 | TAR-T35168 | Xenygloxal | TargetMol | |
| 1500742 | TAR-T35167L | Xenthiorate hydrochloride | TargetMol | |
| 1500741 | TAR-T35167 | Xenthiorate | TargetMol | |
| 1500740 | TAR-T35166 | Xenognosin | TargetMol | |
| 1500739 | TAR-T35165 | Xenoclauxin | TargetMol | |
| 1500738 | TAR-T35164 | Xenipentone | TargetMol | |
| 1500737 | TAR-T35163 | Xenicin | TargetMol | |
| 1500736 | TAR-T35162 | Xenbucin sodium | TargetMol | |
| 1500735 | TAR-T35161L | Xemilofiban hydrochloride | TargetMol | |
| 1500734 | TAR-T35161 | Xemilofiban | TargetMol | |
| 1500733 | TAR-T35160 | XE 820 | TargetMol | |
| 1500732 | TAR-T35159 | XCT0135908 | TargetMol | |
| 1500731 | TAR-T35158 | Xanthylallantoin | TargetMol | |
| 1500730 | TAR-T35157 | Xanthone oxime | TargetMol | |
| 1500729 | TAR-T35155 | Xanoxic acid | TargetMol | |
| 1500728 | TAR-T35154 | Xanoxate sodium | TargetMol | |
| 1500727 | TAR-T35153 | Xamoterol | TargetMol | |
| 1500726 | TAR-T35152 | Xaliproden | TargetMol | |
| 1500725 | TAR-T35150 | X 910279 | TargetMol | |
| 1500724 | TAR-T35149 | X 14547-A | TargetMol | |
| 1500723 | TAR-T35146 | Wyosine triacetate | TargetMol | |
| 1500722 | TAR-T35145 | Wyosine | TargetMol | |
| 1500721 | TAR-T35144 | Wye | TargetMol | |
| 1500720 | TAR-T35143 | WY 48723 | TargetMol | |
| 1500719 | TAR-T35142 | Wy 40770 | TargetMol | |
| 1500718 | TAR-T35141 | WW-781 | TargetMol | |
| 1500717 | TAR-T35140 | WV 760 | TargetMol | |
| 1500716 | TAR-T35138 | WR 216100 | TargetMol | |
| 1500715 | TAR-T35137 | WP814 | TargetMol | |
| 1500714 | TAR-T35136 | Woodrosin I | TargetMol | |
| 1500713 | TAR-T35135 | WN1316 | TargetMol | |
| 1500712 | TAR-T35134 | WK-30 | TargetMol | |
| 1500711 | TAR-T35133 | WIN-68056 | TargetMol | |
| 1500710 | TAR-T35132 | Wieland-gumlich aldehyde | TargetMol | |
| 1500709 | TAR-T35131 | Wedeloside | TargetMol | |
| 1500708 | TAR-T35130 | Wedelin | TargetMol | |
| 1500707 | TAR-T35129 | Web 2118 | TargetMol | |
| 1500706 | TAR-T35128 | Web 2105 | TargetMol | |
| 1500705 | TAR-T35127 | Web 2098 | TargetMol | |
| 1500704 | TAR-T35126 | WE 1073 | TargetMol | |
| 1500703 | TAR-T35125 | We 1008 | TargetMol | |
| 1500702 | TAR-T35124 | Wd 67-2 | TargetMol | |
| 1500701 | TAR-T35123 | WB-4123 | TargetMol | |
| 1500700 | TAR-T35122 | WB 4371 | TargetMol | |
| 1500699 | TAR-T35121 | WB 4291 | TargetMol | |
| 1500698 | TAR-T35120 | WB 4093 | TargetMol | |
| 1500697 | TAR-T35119 | WB 3559 D | TargetMol | |
| 1500696 | TAR-T35118 | WB 3559 C | TargetMol | |
| 1500695 | TAR-T35117 | WB 3559 B | TargetMol | |
| 1500694 | TAR-T35116 | WB 3559 A | TargetMol | |
| 1500693 | TAR-T35115 | WB 2838 | TargetMol | |
| 1500692 | TAR-T35114 | WAY-123398 free base | TargetMol | |
| 1500691 | TAR-T35113 | WAY 150138 | TargetMol | |
| 1500690 | TAR-T35112 | WAY 126299A | TargetMol | |
| 1500689 | TAR-T35111 | Way 125971 | TargetMol | |
| 1500688 | TAR-T35110 | Way 123783 | TargetMol | |
| 1500687 | TAR-T35109 | Way 123223 | TargetMol | |
| 1500686 | TAR-T35108 | Way 120744 | TargetMol | |
| 1500685 | TAR-T35107 | Way 120491 | TargetMol |